PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA005178-PA
Common NameOsI_05220
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family bHLH
Protein Properties Length: 181aa    MW: 19814.3 Da    PI: 5.0131
Description bHLH family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA005178-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HLH45.11.8e-1470122155
                       CHHHHHHHHHHHHHHHHHHHHHHHCTSCCC...TTS-STCHHHHHHHHHHHHHHH CS
               HLH   1 rrrahnerErrRRdriNsafeeLrellPkaskapskKlsKaeiLekAveYIksLq 55 
                       r+ +hn+ Er RR+++N+ ++ Lr llP a   + kKls  +++ ++ +YI +Lq
  BGIOSGA005178-PA  70 RKLSHNAYERDRRKQLNELYSSLRALLPDA--DHTKKLSIPTTVSRVLKYIPELQ 122
                       6889*************************7..35666***************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF474591.83E-1667137IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
CDDcd000831.75E-1269126No hitNo description
PROSITE profilePS5088813.95469121IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene3DG3DSA:4.10.280.104.8E-1370137IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
PfamPF000101.2E-1170122IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
SMARTSM003538.4E-1075127IPR011598Myc-type, basic helix-loop-helix (bHLH) domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 181 aa     Download sequence    Send to blast
MEQLFVDDPA FASSMSSLEA DIFSGAGQLP SSPWLDLDHL DDDVQDLSMA PTTANTVSSG  60
YGSGGSGSHR KLSHNAYERD RRKQLNELYS SLRALLPDAD HTKKLSIPTT VSRVLKYIPE  120
LQKQVENLER KKKELTATST TNCKPGVLGN QMMSEGMAPI VSATCINDME IMVQNPDRPS  180
V
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Os.218930.0callus| leaf| root| seed| stem
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO329834080.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankCT8335970.0CT833597.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCRA113H03, full insert sequence.
GenBankCT8335980.0CT833598.1 Oryza sativa (indica cultivar-group) cDNA clone:OSIGCSA042K05, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015612709.11e-100PREDICTED: transcription factor bHLH100
SwissprotQ9M1K17e-25ORG2_ARATH; Transcription factor ORG2
TrEMBLB8A9781e-133B8A978_ORYSI; Putative uncharacterized protein
STRINGBGIOSGA005178-PA1e-133(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP32803472
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G56970.16e-26bHLH family protein